Details of the Target
General Information of Target
| Target ID | LDTP05628 | |||||
|---|---|---|---|---|---|---|
| Target Name | D site-binding protein (DBP) | |||||
| Gene Name | DBP | |||||
| Gene ID | 1628 | |||||
| Synonyms |
D site-binding protein; Albumin D box-binding protein; Albumin D-element-binding protein; Tax-responsive enhancer element-binding protein 302; TaxREB302 |
|||||
| 3D Structure | ||||||
| Sequence |
MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPA
ATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLD AFLLEHGLPPSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASG HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI MKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE VVAVRQELSHYRAVLSRYQAQHGAL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, PAR subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
This transcriptional activator recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. It is not essential for circadian rhythm generation, but modulates important clock output genes. May be a direct target for regulation by the circadian pacemaker component clock. May affect circadian period and sleep regulation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C157(1.89) | LDD3367 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
References


