Details of the Target
General Information of Target
Target ID | LDTP05618 | |||||
---|---|---|---|---|---|---|
Target Name | Ragulator complex protein LAMTOR4 (LAMTOR4) | |||||
Gene Name | LAMTOR4 | |||||
Gene ID | 389541 | |||||
Synonyms |
C7orf59; Ragulator complex protein LAMTOR4; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4) [Cleaved into: Ragulator complex protein LAMTOR4, N-terminally processed] |
|||||
3D Structure | ||||||
Sequence |
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV |
|||||
Target Bioclass |
Other
|
|||||
Family |
LAMTOR4 family
|
|||||
Subcellular location |
Lysosome
|
|||||
Function |
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K88(10.00) | LDD0277 | [1] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0149 | [2] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] |
The Interaction Atlas With This Target
References