Details of the Target
General Information of Target
| Target ID | LDTP05589 | |||||
|---|---|---|---|---|---|---|
| Target Name | Myotonin-protein kinase (DMPK) | |||||
| Gene Name | DMPK | |||||
| Gene ID | 1760 | |||||
| Synonyms |
DM1PK; MDPK; Myotonin-protein kinase; MT-PK; EC 2.7.11.1; DM-kinase; DMK; DM1 protein kinase; DMPK; Myotonic dystrophy protein kinase |
|||||
| 3D Structure | ||||||
| Sequence |
MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVR
LKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREER DVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIV MAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSP EILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLP LVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEG ATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVL TRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPS PRATDPPSHLDGPPAVAVGQCPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSR AAALGCIGLVAHAGQLTAVWRRPGAARAP |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, AGC Ser/Thr protein kinase family, DMPK subfamily
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane; Mitochondrion membrane
|
|||||
| Function |
Non-receptor serine/threonine protein kinase which is necessary for the maintenance of skeletal muscle structure and function. May play a role in myocyte differentiation and survival by regulating the integrity of the nuclear envelope and the expression of muscle-specific genes. May also phosphorylate PPP1R12A and inhibit the myosin phosphatase activity to regulate myosin phosphorylation. Also critical to the modulation of cardiac contractility and to the maintenance of proper cardiac conduction activity probably through the regulation of cellular calcium homeostasis. Phosphorylates PLN, a regulator of calcium pumps and may regulate sarcoplasmic reticulum calcium uptake in myocytes. May also phosphorylate FXYD1/PLM which is able to induce chloride currents. May also play a role in synaptic plasticity.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cardiac phospholamban (PLN) | Phospholamban family | P26678 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ataxin-1 (ATXN1) | ATXN1 family | P54253 | |||
The Drug(s) Related To This Target
Phase 2
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Isis-dmpk | Antisense drug | D0X9WC | |||
Investigative
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| 2-moe Phosphorothioate Gapmers | Antisense drug | D0P4MA | |||
| Pro-135 | Antisense drug | D0N7HT | |||
| Rki-1447 | Small molecular drug | D03CPB | |||
| Bisindolylmaleimide Viii | . | DB01946 | |||

