Details of the Target
General Information of Target
| Target ID | LDTP05544 | |||||
|---|---|---|---|---|---|---|
| Target Name | Regulator of G-protein signaling 1 (RGS1) | |||||
| Gene Name | RGS1 | |||||
| Gene ID | 5996 | |||||
| Synonyms |
1R20; BL34; IER1; Regulator of G-protein signaling 1; RGS1; B-cell activation protein BL34; Early response protein 1R20 |
|||||
| 3D Structure | ||||||
| Sequence |
MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT LMEKDSYPRFLKSDIYLNLLNDLQANSLK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors. Inhibits B cell chemotaxis toward CXCL12. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C170(1.52) | LDD3419 | [1] | |
|
BTD Probe Info |
![]() |
C131(1.92) | LDD2102 | [2] | |
Competitor(s) Related to This Target
References


