Details of the Target
General Information of Target
| Target ID | LDTP05431 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein EMX2 (EMX2) | |||||
| Gene Name | EMX2 | |||||
| Gene ID | 2018 | |||||
| Synonyms |
Homeobox protein EMX2; Empty spiracles homolog 2; Empty spiracles-like protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAG
RGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFY PWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVV GAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHHINRWRIATKQ ASPEEIDVTSDD |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
EMX homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor, which in cooperation with EMX1, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combination with OTX1/2 to specify cell fates in the developing central nervous system.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
N1 Probe Info |
![]() |
E216(0.00); E217(0.00); S219(0.00); S221(0.00) | LDD0245 | [1] | |
The Interaction Atlas With This Target

