Details of the Target
General Information of Target
| Target ID | LDTP05390 | |||||
|---|---|---|---|---|---|---|
| Target Name | cAMP-responsive element modulator (CREM) | |||||
| Gene Name | CREM | |||||
| Gene ID | 1390 | |||||
| Synonyms |
cAMP-responsive element modulator; Inducible cAMP early repressor; ICER |
|||||
| 3D Structure | ||||||
| Sequence |
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS YRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation.; [Isoform 6]: May play a role in the regulation of the circadian clock: acts as a transcriptional repressor of the core circadian component PER1 by directly binding to cAMP response elements in its promoter.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
13.41 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K311(6.53) | LDD2217 | [2] | |
|
DBIA Probe Info |
![]() |
C98(2.71) | LDD3331 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Neuron-specific calcium-binding protein hippocalcin (HPCA) | Recoverin family | P84074 | |||
Transcription factor
Other
References



