Details of the Target
General Information of Target
| Target ID | LDTP05335 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ammonium transporter Rh type A (RHAG) | |||||
| Gene Name | RHAG | |||||
| Gene ID | 6005 | |||||
| Synonyms |
RH50; Ammonium transporter Rh type A; Erythrocyte membrane glycoprotein Rh50; Erythrocyte plasma membrane 50 kDa glycoprotein; Rh50A; Rhesus blood group family type A glycoprotein; Rh family type A glycoprotein; Rh type A glycoprotein; Rhesus blood group-associated ammonia channel; Rhesus blood group-associated glycoprotein; CD antigen CD241
|
|||||
| 3D Structure | ||||||
| Sequence |
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVM
IFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADF SAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAY FGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAI VNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIG SIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAM QAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Ammonium transporter (TC 2.A.49) family, Rh subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane. Heterotrimer with RHCE (RHAG)2(RHCE), that transports ammonium and its related derivative methylammonium, in both neutral and ionic forms, across the erythrocyte membrane. The transport of NH4(+) is electrogenic and masks the NH3 transport. Also, may act as a CO2 channel. In vitro, leaks monovalent cations. Moreover in erythrocyte, regulates RHD membrane expression and is associated with rhesus blood group antigen expression.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C396(1.17) | LDD2324 | [1] | |
Competitor(s) Related to This Target

