Details of the Target
General Information of Target
| Target ID | LDTP05290 | |||||
|---|---|---|---|---|---|---|
| Target Name | Myosin regulatory light chain 2, atrial isoform (MYL7) | |||||
| Gene Name | MYL7 | |||||
| Gene ID | 58498 | |||||
| Synonyms |
MYL2A; MYLC2A; Myosin regulatory light chain 2, atrial isoform; MLC-2a; MLC2a; Myosin light chain 2a; Myosin regulatory light chain 7 |
|||||
| 3D Structure | ||||||
| Sequence |
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C164(2.24) | LDD2282 | [1] | |
|
Acrolein Probe Info |
![]() |
C164(0.00); H169(0.00) | LDD0222 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Sulfite oxidase, mitochondrial (SUOX) | . | P51687 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| POU domain, class 6, transcription factor 2 (POU6F2) | POU transcription factor family | P78424 | |||
| TOX high mobility group box family member 4 (TOX4) | . | O94842 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Mitochondrial coiled-coil domain protein 1 (MCCD1) | . | P59942 | |||
| Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) | . | Q9UIG4 | |||
References


