General Information of Target

Target ID LDTP05283
Target Name Runt-related transcription factor 1 (RUNX1)
Gene Name RUNX1
Gene ID 861
Synonyms
AML1; CBFA2; Runt-related transcription factor 1; Acute myeloid leukemia 1 protein; Core-binding factor subunit alpha-2; CBF-alpha-2; Oncogene AML-1; Polyomavirus enhancer-binding protein 2 alpha B subunit; PEA2-alpha B; PEBP2-alpha B; SL3-3 enhancer factor 1 alpha B subunit; SL3/AKV core-binding factor alpha B subunit
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
Target Type
Literature-reported
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). Essential for the development of normal hematopoiesis. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. Inhibits KAT6B-dependent transcriptional activation. Involved in lineage commitment of immature T cell precursors. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing. Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down-regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells. Positively regulates the expression of RORC in T-helper 17 cells.; Isoform AML-1G shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation.; Isoform AML-1L interferes with the transactivation activity of RUNX1.
TTD ID
T43711
Uniprot ID
Q01196
DrugMap ID
TTWIN3H
Ensemble ID
ENST00000300305.7
HGNC ID
HGNC:10471

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C99(1.56)  LDD3451  [1]
4-Iodoacetamidophenylacetylene
 Probe Info 
N.A.  LDD0038  [2]
IA-alkyne
 Probe Info 
N.A.  LDD0036  [2]
Lodoacetamide azide
 Probe Info 
N.A.  LDD0037  [2]
Compound 10
 Probe Info 
N.A.  LDD2216  [3]
Compound 11
 Probe Info 
N.A.  LDD2213  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A2058 C99(1.44)  LDD2253  [1]
 LDCM0023  KB03 A2058 C99(1.78)  LDD2670  [1]
 LDCM0024  KB05 SUP-T1 C99(1.56)  LDD3451  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclin-dependent kinase 6 (CDK6) CMGC Ser/Thr protein kinase family Q00534
Homeodomain-interacting protein kinase 2 (HIPK2) CMGC Ser/Thr protein kinase family Q9H2X6
F-box only protein 17 (FBXO17) . Q96EF6
Transcription factor
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Core-binding factor subunit beta (CBFB) CBF-beta family Q13951
ETS-related transcription factor Elf-2 (ELF2) ETS family Q15723
High mobility group protein HMGI-C (HMGA2) HMGA family P52926
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Oligodendrocyte transcription factor 3 (OLIG3) . Q7RTU3
T-cell acute lymphocytic leukemia protein 1 (TAL1) . P17542
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM222B (FAM222B) FAM222 family Q8WU58
Tektin-5 (TEKT5) Tektin family Q96M29
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
Transducin-like enhancer protein 1 (TLE1) WD repeat Groucho/TLE family Q04724
Transcriptional coactivator YAP1 (YAP1) YAP1 family P46937
BAG family molecular chaperone regulator 3 (BAG3) . O95817
BAG family molecular chaperone regulator 4 (BAG4) . O95429
GRIP and coiled-coil domain-containing protein 1 (GCC1) . Q96CN9
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279