Details of the Target
General Information of Target
| Target ID | LDTP05261 | |||||
|---|---|---|---|---|---|---|
| Target Name | Pregnancy-specific beta-1-glycoprotein 9 (PSG9) | |||||
| Gene Name | PSG9 | |||||
| Gene ID | 5678 | |||||
| Synonyms |
PSG11; Pregnancy-specific beta-1-glycoprotein 9; PS-beta-G-9; PSBG-9; Pregnancy-specific glycoprotein 9; PS34; Pregnancy-specific beta-1 glycoprotein B; PS-beta-B; Pregnancy-specific beta-1-glycoprotein 11; PS-beta-G-11; PSBG-11; Pregnancy-specific glycoprotein 11; Pregnancy-specific glycoprotein 7; PSG7
|
|||||
| 3D Structure | ||||||
| Sequence |
MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQ
NLPGYFWYKGEMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTY TLHIIKRGDETREEIRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLW WMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLP IPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSV TRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNP PAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGD LTESQS |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Immunoglobulin superfamily, CEA family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Binds to the small latent transforming growth factor-beta complex, consisting of the N-terminal TGFB1 latency-associated peptide (LAP) and the mature form of TGFB1, thereby leading to the activation of TGFB1. The activation of TGFB1 leads to stimulation of naive CD4(+) T-cells to increase FoxP3 expression and to an increase in the number of FoxP3(+) regulatory T-cells. Induces the differentiation of a suppressive CD4(+)LAP(+)FoxP3(-) T-cell subset. Induces the secretion of TGFB1 in macrophages, but not in activated CD4(+) T-cells. May reduce the expression of several pro-inflammatory cytokines and chemokines by CD4(+) T-cells, including IL2 and IL6.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C417(3.76) | LDD2284 | [1] | |
Competitor(s) Related to This Target

