Details of the Target
General Information of Target
| Target ID | LDTP05251 | |||||
|---|---|---|---|---|---|---|
| Target Name | Norrin (NDP) | |||||
| Gene Name | NDP | |||||
| Gene ID | 4693 | |||||
| Synonyms |
EVR2; Norrin; Norrie disease protein; X-linked exudative vitreoretinopathy 2 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMV
LLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATY RYILSCHCEECNS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. Plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. Acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). May be involved in a pathway that regulates neural cell differentiation and proliferation. Possible role in neuroectodermal cell-cell interaction.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C65(49.05); C69(49.05) | LDD0209 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target