Details of the Target
General Information of Target
| Target ID | LDTP05241 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein Hox-C5 (HOXC5) | |||||
| Gene Name | HOXC5 | |||||
| Gene ID | 3222 | |||||
| Synonyms |
HOX3D; Homeobox protein Hox-C5; Homeobox protein CP11; Homeobox protein Hox-3D |
|||||
| 3D Structure | ||||||
| Sequence |
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHG
VDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKE EQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYL TRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Antp homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C76(1.89) | LDD3402 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| DNA-directed RNA polymerase II subunit RPB7 (POLR2G) | Eukaryotic RPB7/RPC8 RNA polymerase subunit family | P62487 | |||
Transcription factor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Segment polarity protein dishevelled homolog DVL-3 (DVL3) | DSH family | Q92997 | |||
| Golgi reassembly-stacking protein 2 (GORASP2) | GORASP family | Q9H8Y8 | |||
References


