Details of the Target
General Information of Target
| Target ID | LDTP05155 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-X-C motif chemokine 6 (CXCL6) |
|
||||
| Gene Name | CXCL6 | |||||
| Gene ID | 6372 | |||||
| Synonyms |
GCP2; SCYB6; C-X-C motif chemokine 6; Chemokine alpha 3; CKA-3; Granulocyte chemotactic protein 2; GCP-2; Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1; Small-inducible cytokine B6, N-processed variant 2; Small-inducible cytokine B6, N-processed variant 3]
|
|||||
| 3D Structure | ||||||
| Sequence |
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP
KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-negative bacteria (90-fold-higher when compared to CXCL5 and CXCL7).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C75(3.24) | LDD3310 | [1] | |
Competitor(s) Related to This Target