Details of the Target
General Information of Target
| Target ID | LDTP05147 | |||||
|---|---|---|---|---|---|---|
| Target Name | Death domain-containing protein CRADD (CRADD) |
|
||||
| Gene Name | CRADD | |||||
| Gene ID | 8738 | |||||
| Synonyms |
RAIDD; Death domain-containing protein CRADD; Caspase and RIP adapter with death domain; RIP-associated protein with a death domain |
|||||
| 3D Structure | ||||||
| Sequence |
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQI NQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSL HNGLRAVEVDPSLLLHMLE |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Adapter protein that associates with PIDD1 and the caspase CASP2 to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis. Also recruits CASP2 to the TNFR-1 signaling complex through its interaction with RIPK1 and TRADD and may play a role in the tumor necrosis factor-mediated signaling pathway.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [1] | |
|
m-APA Probe Info |
 |
N.A. | LDD2231 | [1] | |