Details of the Target
General Information of Target
| Target ID | LDTP05124 | |||||
|---|---|---|---|---|---|---|
| Target Name | Iroquois-class homeodomain protein IRX-5 (IRX5) | |||||
| Gene Name | IRX5 | |||||
| Gene ID | 10265 | |||||
| Synonyms |
IRX2A; IRXB2; Iroquois-class homeodomain protein IRX-5; Homeodomain protein IRX-2A; Homeodomain protein IRXB2; Iroquois homeobox protein 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPG
YNSHLQYGADPAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNA TRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWT PRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPEAGGAEQKAASGCERLQGPPTPAG KETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAAARLAEDPAPHYPAGAPAPGP HPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDGGGGNEGSPCP PCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGH LHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGM SDI |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
TALE/IRO homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Establishes the cardiac repolarization gradient by its repressive actions on the KCND2 potassium-channel gene. Required for retinal cone bipolar cell differentiation. May regulate contrast adaptation in the retina and control specific aspects of visual function in circuits of the mammalian retina. Could be involved in the regulation of both the cell cycle and apoptosis in prostate cancer cells. Involved in craniofacial and gonadal development. Modulates the migration of progenitor cell populations in branchial arches and gonads by repressing CXCL12.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| 22RV1 | Insertion: p.R269PfsTer99 | DBIA Probe Info | |||
| AN3CA | SNV: p.D286G | . | |||
| EFO27 | SNV: p.L17P | . | |||
| HL60 | SNV: p.Y291S | . | |||
| IM95 | SNV: p.A167V | . | |||
| Ishikawa (Heraklio) 02 ER | SNV: p.S40T | . | |||
| MCC26 | Substitution: p.G37N | . | |||
| MOLT4 | SNV: p.R461W | . | |||
| NCIH2172 | Substitution: p.A73S | . | |||
| NCIH661 | SNV: p.L97F | . | |||
| OCUG1 | SNV: p.P267T | . | |||
| SKNSH | SNV: p.Q223K | . | |||
| SKOV3 | SNV: p.H290R | . | |||
| SW1271 | SNV: p.G50C | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C229(2.57) | LDD3337 | [1] | |
Competitor(s) Related to This Target
References

