Details of the Target
General Information of Target
| Target ID | LDTP05072 | |||||
|---|---|---|---|---|---|---|
| Target Name | Peptidyl-prolyl cis-trans isomerase FKBP1B (FKBP1B) | |||||
| Gene Name | FKBP1B | |||||
| Gene ID | 2281 | |||||
| Synonyms |
FKBP12.6; FKBP1L; FKBP9; OTK4; Peptidyl-prolyl cis-trans isomerase FKBP1B; PPIase FKBP1B; EC 5.2.1.8; 12.6 kDa FK506-binding protein; 12.6 kDa FKBP; FKBP-12.6; FK506-binding protein 1B; FKBP-1B; Immunophilin FKBP12.6; Rotamase; h-FKBP-12
|
|||||
| 3D Structure | ||||||
| Sequence |
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
FKBP-type PPIase family, FKBP1 subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Ryanodine receptor 2 (RYR2) | Ryanodine receptor family | Q92736 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Proto-oncogene c-Rel (REL) | . | Q04864 | |||
Other

