Details of the Target
General Information of Target
| Target ID | LDTP05018 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA-directed RNA polymerases I, II, and III subunit RPABC5 (POLR2L) | |||||
| Gene Name | POLR2L | |||||
| Gene ID | 5441 | |||||
| Synonyms |
DNA-directed RNA polymerases I, II, and III subunit RPABC5; RNA polymerases I, II, and III subunit ABC5; DNA-directed RNA polymerase III subunit L; RNA polymerase II 7.6 kDa subunit; RPB7.6; RPB10 homolog
|
|||||
| 3D Structure | ||||||
| Sequence |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Archaeal Rpo10/eukaryotic RPB10 RNA polymerase subunit family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y62(7.49) | LDD0257 | [1] | |
|
STPyne Probe Info |
![]() |
K67(2.44) | LDD0277 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
Other
References


