Details of the Target
General Information of Target
| Target ID | LDTP04968 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquitin-conjugating enzyme E2 H (UBE2H) | |||||
| Gene Name | UBE2H | |||||
| Gene ID | 7328 | |||||
| Synonyms |
Ubiquitin-conjugating enzyme E2 H; EC 2.3.2.23; (E3-independent) E2 ubiquitin-conjugating enzyme H; EC 2.3.2.24; E2 ubiquitin-conjugating enzyme H; UbcH2; Ubiquitin carrier protein H; Ubiquitin-conjugating enzyme E2-20K; Ubiquitin-protein ligase H
|
|||||
| 3D Structure | ||||||
| Sequence |
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDK
YPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPID PLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQD MEL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Ubiquitin-conjugating enzyme family
|
|||||
| Function |
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. E2 ubiquitin conjugating enzyme that transfers ubiquitin to MAEA, a core component of the CTLH E3 ubiquitin-protein ligase complex. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
15.00 | LDD0402 | [1] | |
|
STPyne Probe Info |
![]() |
K60(2.55); K64(3.96) | LDD0277 | [2] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 (GNB2) | WD repeat G protein beta family | P62879 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Melanoma-associated antigen 2 (MAGEA2; MAGEA2B) | . | P43356 | |||
| Melanoma-associated antigen C2 (MAGEC2) | . | Q9UBF1 | |||
References



