Details of the Target
General Information of Target
| Target ID | LDTP04912 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein max (MAX) | |||||
| Gene Name | MAX | |||||
| Gene ID | 4149 | |||||
| Synonyms |
BHLHD4; Protein max; Class D basic helix-loop-helix protein 4; bHLHd4; Myc-associated factor X |
|||||
| 3D Structure | ||||||
| Sequence |
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
MAX family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC:MAX complex is a transcriptional activator, whereas the MAD:MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity. Represses MYC transcriptional activity from E-box elements.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [1] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Wolframin (WFS1) | . | O76024 | |||
Transcription factor
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Gamma-aminobutyric acid type B receptor subunit 1 (GABBR1) | G-protein coupled receptor 3 family | Q9UBS5 | |||
Other
References


