General Information of Target

Target ID LDTP04883
Target Name 26S proteasome complex subunit SEM1 (SEM1)
Gene Name SEM1
Gene ID 7979
Synonyms
C7orf76; DSS1; SHFDG1; SHFM1; 26S proteasome complex subunit SEM1; 26S proteasome complex subunit DSS1; Deleted in split hand/split foot protein 1; Split hand/foot deleted protein 1; Split hand/foot malformation type 1 protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
Target Bioclass
Other
Family
DSS1/SEM1 family
Subcellular location
Nucleus
Function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and thus transcription-associated genomic instability. R-loop accumulation increases in SEM1-depleted cells.
Uniprot ID
P60896
Ensemble ID
ENST00000248566.4
HGNC ID
HGNC:10845
ChEMBL ID
CHEMBL2364701

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 SNV: p.F22L .
IM95 SNV: p.Ter71YextTer8 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K62(9.09); K66(2.78)  LDD0277  [1]
ATP probe
 Probe Info 
N.A.  LDD0199  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Superoxide dismutase [Cu-Zn] (SOD1) Cu-Zn superoxide dismutase family P00441
26S proteasome non-ATPase regulatory subunit 3 (PSMD3) Proteasome subunit S3 family O43242
Leucine-rich repeat serine/threonine-protein kinase 2 (LRRK2) TKL Ser/Thr protein kinase family Q5S007
Transcription initiation factor IIB (GTF2B) TFIIB family Q00403
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PCI domain-containing protein 2 (PCID2) CSN12 family Q5JVF3
Progranulin (GRN) Granulin family P28799
Protein Dr1 (DR1) NC2 beta/DR1 family Q01658
RNA-binding protein FUS (FUS) RRM TET family P35637
Breast cancer type 2 susceptibility protein (BRCA2) . P51587
General transcription factor 3C polypeptide 3 (GTF3C3) . Q9Y5Q9

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.