Details of the Target
General Information of Target
| Target ID | LDTP04852 | |||||
|---|---|---|---|---|---|---|
| Target Name | Myelin proteolipid protein (PLP1) |
|
||||
| Gene Name | PLP1 | |||||
| Gene ID | 5354 | |||||
| Synonyms |
PLP; Myelin proteolipid protein; PLP; Lipophilin |
|||||
| 3D Structure | ||||||
| Sequence |
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEY
LINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGG QKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNT WTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLF IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Myelin proteolipid protein family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C201(1.57) | LDD3376 | [1] | |
Competitor(s) Related to This Target