Details of the Target
General Information of Target
| Target ID | LDTP04848 | |||||
|---|---|---|---|---|---|---|
| Target Name | Beta-defensin 1 (DEFB1) | |||||
| Gene Name | DEFB1 | |||||
| Gene ID | 1672 | |||||
| Synonyms |
BD1; HBD1; Beta-defensin 1; BD-1; hBD-1; Defensin, beta 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY
RGKAKCCK |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Beta-defensin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C59(1.79) | LDD2379 | [1] | |
Competitor(s) Related to This Target