Details of the Target
General Information of Target
| Target ID | LDTP04773 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type F-S (H2BC12L) | |||||
| Gene Name | H2BC12L | |||||
| Gene ID | 102724334 | |||||
| Synonyms |
H2BFS; H2BS1; Histone H2B type F-S; H2B-clustered histone 12 like; H2B.S histone 1; Histone H2B.s; H2B/s |
|||||
| 3D Structure | ||||||
| Sequence |
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K58(19.71); K109(20.00); K121(11.96); K44(20.00) | LDD2217 | [1] | |
|
Acrolein Probe Info |
 |
H110(0.00); H50(0.00) | LDD0217 | [2] | |
|
Crotonaldehyde Probe Info |
 |
H50(0.00); H110(0.00) | LDD0219 | [2] | |
|
Methacrolein Probe Info |
 |
H50(0.00); H110(0.00); K109(0.00); K117(0.00) | LDD0218 | [2] | |
|
HHS-465 Probe Info |
 |
K109(0.00); K117(0.00); K12(0.00); K21(0.00) | LDD2240 | [3] | |
Competitor(s) Related to This Target
References