Details of the Target
General Information of Target
| Target ID | LDTP04748 | |||||
|---|---|---|---|---|---|---|
| Target Name | ADP-ribosylation factor-like protein 4C (ARL4C) | |||||
| Gene Name | ARL4C | |||||
| Gene ID | 10123 | |||||
| Synonyms |
ARL7; ADP-ribosylation factor-like protein 4C; ADP-ribosylation factor-like protein 7; ADP-ribosylation factor-like protein LAK |
|||||
| 3D Structure | ||||||
| Sequence |
MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAK
GISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGT PLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMIL KRRKSLKQKKKR |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Arf family
|
|||||
| Subcellular location |
Cell projection, filopodium
|
|||||
| Function |
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. May be involved in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in the GDP-bound form. Regulates the microtubule-dependent intracellular vesicular transport from early endosome to recycling endosome process.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C64(1.10) | LDD1571 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD2241 | [2] | |
|
Lodoacetamide azide Probe Info |
![]() |
C64(0.00); C85(0.00) | LDD0037 | [2] | |
|
NAIA_4 Probe Info |
![]() |
C64(0.00); C85(0.00) | LDD2226 | [3] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0367 | CL1 | HEK-293T | C64(1.10) | LDD1571 | [1] |
| LDCM0370 | CL101 | HEK-293T | C64(1.00) | LDD1574 | [1] |
| LDCM0371 | CL102 | HEK-293T | C64(1.17) | LDD1575 | [1] |
| LDCM0374 | CL105 | HEK-293T | C64(1.08) | LDD1578 | [1] |
| LDCM0375 | CL106 | HEK-293T | C64(0.93) | LDD1579 | [1] |
| LDCM0378 | CL109 | HEK-293T | C64(0.96) | LDD1582 | [1] |
| LDCM0380 | CL110 | HEK-293T | C64(1.22) | LDD1584 | [1] |
| LDCM0383 | CL113 | HEK-293T | C64(0.96) | LDD1587 | [1] |
| LDCM0384 | CL114 | HEK-293T | C64(1.12) | LDD1588 | [1] |
| LDCM0387 | CL117 | HEK-293T | C64(1.13) | LDD1591 | [1] |
| LDCM0388 | CL118 | HEK-293T | C64(1.12) | LDD1592 | [1] |
| LDCM0392 | CL121 | HEK-293T | C64(1.01) | LDD1596 | [1] |
| LDCM0393 | CL122 | HEK-293T | C64(0.95) | LDD1597 | [1] |
| LDCM0396 | CL125 | HEK-293T | C64(0.84) | LDD1600 | [1] |
| LDCM0397 | CL126 | HEK-293T | C64(1.08) | LDD1601 | [1] |
| LDCM0400 | CL13 | HEK-293T | C64(1.07) | LDD1604 | [1] |
| LDCM0401 | CL14 | HEK-293T | C64(1.22) | LDD1605 | [1] |
| LDCM0407 | CL2 | HEK-293T | C64(1.33) | LDD1611 | [1] |
| LDCM0413 | CL25 | HEK-293T | C64(0.97) | LDD1617 | [1] |
| LDCM0414 | CL26 | HEK-293T | C64(1.04) | LDD1618 | [1] |
| LDCM0426 | CL37 | HEK-293T | C64(1.05) | LDD1630 | [1] |
| LDCM0439 | CL49 | HEK-293T | C64(0.96) | LDD1643 | [1] |
| LDCM0441 | CL50 | HEK-293T | C64(1.18) | LDD1645 | [1] |
| LDCM0453 | CL61 | HEK-293T | C64(0.96) | LDD1656 | [1] |
| LDCM0454 | CL62 | HEK-293T | C64(1.15) | LDD1657 | [1] |
| LDCM0466 | CL73 | HEK-293T | C64(1.11) | LDD1669 | [1] |
| LDCM0467 | CL74 | HEK-293T | C64(1.15) | LDD1670 | [1] |
| LDCM0479 | CL85 | HEK-293T | C64(0.93) | LDD1682 | [1] |
| LDCM0480 | CL86 | HEK-293T | C64(0.93) | LDD1683 | [1] |
| LDCM0492 | CL97 | HEK-293T | C64(1.09) | LDD1695 | [1] |
| LDCM0493 | CL98 | HEK-293T | C64(1.07) | LDD1696 | [1] |
| LDCM0427 | Fragment51 | HEK-293T | C64(1.25) | LDD1631 | [1] |
References






