Details of the Target
General Information of Target
| Target ID | LDTP04728 | |||||
|---|---|---|---|---|---|---|
| Target Name | NADH dehydrogenase flavoprotein 3, mitochondrial (NDUFV3) | |||||
| Gene Name | NDUFV3 | |||||
| Gene ID | 4731 | |||||
| Synonyms |
NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial; Complex I-9kD; CI-9kD; NADH-ubiquinone oxidoreductase 9 kDa subunit; Renal carcinoma antigen NY-REN-4 |
|||||
| 3D Structure | ||||||
| Sequence |
MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP
VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I NDUFV3 subunit family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. May be the terminally assembled subunit of Complex I.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
![]() |
Y71(18.22) | LDD3495 | [1] | |

