General Information of Target

Target ID LDTP04672
Target Name Proteinase-activated receptor 2 (F2RL1)
Gene Name F2RL1
Gene ID 2150
Synonyms
GPR11; PAR2; Proteinase-activated receptor 2; PAR-2; Coagulation factor II receptor-like 1; G-protein coupled receptor 11; Thrombin receptor-like 1) [Cleaved into: Proteinase-activated receptor 2, alternate cleaved 1; Proteinase-activated receptor 2, alternate cleaved 2]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
Target Type
Clinical trial
Target Bioclass
GPCR
Family
G-protein coupled receptor 1 family
Subcellular location
Cell membrane
Function
Receptor for trypsin and trypsin-like enzymes coupled to G proteins. Its function is mediated through the activation of several signaling pathways including phospholipase C (PLC), intracellular calcium, mitogen-activated protein kinase (MAPK), I-kappaB kinase/NF-kappaB and Rho. Can also be transactivated by cleaved F2R/PAR1. Involved in modulation of inflammatory responses and regulation of innate and adaptive immunity, and acts as a sensor for proteolytic enzymes generated during infection. Generally is promoting inflammation. Can signal synergistically with TLR4 and probably TLR2 in inflammatory responses and modulates TLR3 signaling. Has a protective role in establishing the endothelial barrier; the activity involves coagulation factor X. Regulates endothelial cell barrier integrity during neutrophil extravasation, probably following proteolytic cleavage by PRTN3. Proposed to have a bronchoprotective role in airway epithelium, but also shown to compromise the airway epithelial barrier by interrupting E-cadherin adhesion. Involved in the regulation of vascular tone; activation results in hypotension presumably mediated by vasodilation. Associates with a subset of G proteins alpha subunits such as GNAQ, GNA11, GNA14, GNA12 and GNA13, but probably not with G(o)-alpha, G(i) subunit alpha-1 and G(i) subunit alpha-2. However, according tocan signal through G(i) subunit alpha. Believed to be a class B receptor which internalizes as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptor, for extended periods of time. Mediates inhibition of TNF-alpha stimulated JNK phosphorylation via coupling to GNAQ and GNA11; the function involves dissociation of RIPK1 and TRADD from TNFR1. Mediates phosphorylation of nuclear factor NF-kappa-B RELA subunit at 'Ser-536'; the function involves IKBKB and is predominantly independent of G proteins. Involved in cellular migration. Involved in cytoskeletal rearrangement and chemotaxis through beta-arrestin-promoted scaffolds; the function is independent of GNAQ and GNA11 and involves promotion of cofilin dephosphorylation and actin filament severing. Induces redistribution of COPS5 from the plasma membrane to the cytosol and activation of the JNK cascade is mediated by COPS5. Involved in the recruitment of leukocytes to the sites of inflammation and is the major PAR receptor capable of modulating eosinophil function such as pro-inflammatory cytokine secretion, superoxide production and degranulation. During inflammation promotes dendritic cell maturation, trafficking to the lymph nodes and subsequent T-cell activation. Involved in antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram-positive and killing of Gram-negative bacteria. Acts synergistically with interferon-gamma in enhancing antiviral responses. Implicated in a number of acute and chronic inflammatory diseases such as of the joints, lungs, brain, gastrointestinal tract, periodontium, skin, and vascular systems, and in autoimmune disorders.
TTD ID
T62841
Uniprot ID
P55085
DrugMap ID
TTD3TZ2
Ensemble ID
ENST00000296677.5
HGNC ID
HGNC:3538
ChEMBL ID
CHEMBL5963

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info 
15.00  LDD0402  [1]
IPM
 Probe Info 
N.A.  LDD0005  [2]
AOyne
 Probe Info 
15.00  LDD0443  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 11.35  LDD0403  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) Cation transport ATPase (P-type) (TC 3.A.3) family P16615
COP9 signalosome complex subunit 5 (COPS5) Peptidase M67A family Q92905
E3 ubiquitin-protein ligase CBL (CBL) . P22681
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transmembrane emp24 domain-containing protein 2 (TMED2) EMP24/GP25L family Q15363
Major prion protein (PRNP) Prion family P04156
Tissue factor (F3) Tissue factor family P13726
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Heat shock 70 kDa protein 1B (HSPA1B) Heat shock protein 70 family P0DMV9

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Gb110 Small molecular drug D07ZNP
Gb88 Small molecular drug D0A5GJ
Askh95 . D0G7FS
Patented
Click To Hide/Show 35 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Amidine Compound 1 Small molecular drug D0VN2U
Amidine Compound 2 Small molecular drug D0WH1K
Amidine Compound 3 Small molecular drug D07HJT
Amidine Compound 4 Small molecular drug D0AK6L
Amidine Compound 5 Small molecular drug D0JT0B
Amidine Compound 6 Small molecular drug D0G2EP
Benzimidazole Derivative 10 Small molecular drug D05VXK
Benzimidazole Derivative 8 Small molecular drug D0Z4SW
Benzimidazole Derivative 9 Small molecular drug D0T6SP
Benzothiazine-carboxamide Compound 1 Small molecular drug D0P7UB
Benzothiazine-carboxamide Compound 2 Small molecular drug D06XWQ
Benzothiazine-carboxamide Compound 3 Small molecular drug D0K9QH
Benzothiazine-carboxamide Compound 4 Small molecular drug D07OVM
Benzothiazine-carboxamide Compound 5 Small molecular drug D0Q8MQ
Benzothiazine-carboxamide Compound 6 Small molecular drug D0H4SE
Imidazopyridazine Derivative 3 Small molecular drug D0UD6X
Imidazopyridazine Derivative 4 Small molecular drug D0UN9X
Imidazopyridazine Derivative 5 Small molecular drug D0G7KY
Imidazopyridazine Derivative 6 Small molecular drug D0W9AB
Imidazopyridazine Derivative 7 Small molecular drug D0N3AF
Imidazopyridazine Derivative 8 Small molecular drug D02SJB
Peptide Analog 71 Small molecular drug D07AXK
Peptide Analog 72 Small molecular drug D0Y9UV
Peptidomimetic Analog 6 Small molecular drug D0D2PU
Piperazine Derivative 5 Small molecular drug D0LT5Y
Piperazine Urea Derivative 3 Small molecular drug D0H1JS
Piperazine Urea Derivative 4 Small molecular drug D04GIJ
Piperidine Derivative 2 Small molecular drug D04YKO
Piperidine Derivative 3 Small molecular drug D0S6SJ
Pmid26936077-compound-13 Small molecular drug D09EIX
Pmid26936077-compound-34 Small molecular drug D0I2RS
Quinazoline Derivative 10 Small molecular drug D0CM5P
Quinazoline Derivative 11 Small molecular drug D08ZEM
Quinazoline Derivative 12 Small molecular drug D0EC3H
Quinazoline Derivative 13 Small molecular drug D0P2BJ

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
3 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.