Details of the Target
General Information of Target
| Target ID | LDTP04658 | |||||
|---|---|---|---|---|---|---|
| Target Name | GTP-binding protein RAD (RRAD) | |||||
| Gene Name | RRAD | |||||
| Gene ID | 6236 | |||||
| Synonyms |
RAD; GTP-binding protein RAD; RAD1; Ras associated with diabetes |
|||||
| 3D Structure | ||||||
| Sequence |
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAA
AGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEA EAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKA SELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNV QALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK SCHDLSVL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, RGK family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
May regulate basal voltage-dependent L-type Ca(2+) currents and be required for beta-adrenergic augmentation of Ca(2+) influx in cardiomyocytes, thereby regulating increases in heart rate and contractile force. May play an important role in cardiac antiarrhythmia via the strong suppression of voltage-gated L-type Ca(2+) currents. Regulates voltage-dependent L-type calcium channel subunit alpha-1C trafficking to the cell membrane. Inhibits cardiac hypertrophy through the calmodulin-dependent kinase II (CaMKII) pathway. Inhibits phosphorylation and activation of CAMK2D.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C302(1.46) | LDD1702 | [1] | |
|
DBIA Probe Info |
![]() |
C227(0.90) | LDD0078 | [2] | |
Competitor(s) Related to This Target
References


