Details of the Target

General Information of Target

Target ID LDTP04657
Target Name GTP-binding protein GEM (GEM)
Gene Name GEM
Gene ID 2669
Synonyms
KIR; GTP-binding protein GEM; GTP-binding mitogen-induced T-cell protein; RAS-like protein KIR
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSS
DSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMV
DGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQ
TEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR
LRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Small GTPase superfamily, RGK family
Subcellular location
Cell membrane
Function
Could be a regulatory protein, possibly participating in receptor-mediated signal transduction at the plasma membrane. Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity.
TTD ID
T35063
Uniprot ID
P55040
DrugMap ID
TTAZF9M
Ensemble ID
ENST00000297596.3
HGNC ID
HGNC:4234

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
NAIA_4
 Probe Info  		N.A.  LDD2226  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 11.83  LDD0403  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
S-adenosylhomocysteine hydrolase-like protein 1 (AHCYL1) Adenosylhomocysteinase family O43865
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Putative histone-lysine N-methyltransferase PRDM6 (PRDM6) Class V-like SAM-binding methyltransferase superfamily Q9NQX0
NADH dehydrogenase 1 beta subcomplex subunit 7 (NDUFB7) Complex I NDUFB7 subunit family P17568
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Exosome complex component RRP43 (EXOSC8) RNase PH family Q96B26
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Protein-glutamine gamma-glutamyltransferase Z (TGM7) Transglutaminase family Q96PF1
E3 ubiquitin-protein ligase TRIM32 (TRIM32) TRIM/RBCC family Q13049
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
pre-mRNA splicing regulator USH1G (USH1G) . Q495M9
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Voltage-dependent L-type calcium channel subunit beta-1 (CACNB1) Calcium channel beta subunit family Q02641
Voltage-dependent L-type calcium channel subunit beta-3 (CACNB3) Calcium channel beta subunit family P54284
Transcription factor
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G protein-coupled receptor associated sorting protein 3 (GPRASP3) GPRASP family Q6PI77
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger and SCAN domain-containing protein 9 (ZSCAN9) Krueppel C2H2-type zinc-finger protein family O15535
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 552 (ZNF552) Krueppel C2H2-type zinc-finger protein family Q9H707
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Zinc finger protein 688 (ZNF688) Krueppel C2H2-type zinc-finger protein family P0C7X2
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein PLAGL2 (PLAGL2) Krueppel C2H2-type zinc-finger protein family Q9UPG8
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
Pre-B-cell leukemia transcription factor 4 (PBX4) TALE/PBX homeobox family Q9BYU1
Golgin-45 (BLZF1) . Q9H2G9
Myogenin (MYOG) . P15173
Transcription factor 4 (TCF4) . P15884
Transcription factor AP-4 (TFAP4) . Q01664
Other
Click To Hide/Show 59 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein beta/alpha (YWHAB) 14-3-3 family P31946
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Ankyrin repeat and SOCS box protein 15 (ASB15) Ankyrin SOCS box (ASB) family Q8WXK1
Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC1S2) BLOC1S2 family Q6QNY1
Coiled-coil domain-containing protein 88B (CCDC88B) CCDC88 family A6NC98
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Conserved oligomeric Golgi complex subunit 8 (COG8) COG8 family Q96MW5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (ECSIT) ECSIT family Q9BQ95
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Iron-sulfur cluster assembly 2 homolog, mitochondrial (ISCA2) HesB/IscA family Q86U28
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Vimentin (VIM) Intermediate filament family P08670
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
LRP chaperone MESD (MESD) MESD family Q14696
Protein Mis18-beta (OIP5) Mis18 family O43482
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
PIH1 domain-containing protein 1 (PIH1D1) PIH1 family Q9NWS0
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
RUN domain-containing protein 3A (RUNDC3A) RUNDC3 family Q59EK9
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Brain-enriched guanylate kinase-associated protein (BEGAIN) . Q9BUH8
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 125 (CCDC125) . Q86Z20
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6
Heat shock factor 2-binding protein (HSF2BP) . O75031
INO80 complex subunit E (INO80E) . Q8NBZ0
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
KATNB1-like protein 1 (KATNBL1) . Q9H079
LRP2-binding protein (LRP2BP) . Q9P2M1
Microspherule protein 1 (MCRS1) . Q96EZ8
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
MORN repeat-containing protein 3 (MORN3) . Q6PF18
PDZ and LIM domain protein 7 (PDLIM7) . Q9NR12
Pleckstrin homology domain-containing family F member 2 (PLEKHF2) . Q9H8W4
Protein inscuteable homolog (INSC) . Q1MX18
Putative protein MSS51 homolog, mitochondrial (MSS51) . Q4VC12
Sperm-associated antigen 5 (SPAG5) . Q96R06
TBC1 domain family member 3G (TBC1D3G) . Q6DHY5
TNF receptor-associated factor 1 (TRAF1) . Q13077
Vinexin (SORBS3) . O60504
Zinc finger C4H2 domain-containing protein (ZC4H2) . Q9NQZ6
Zinc finger matrin-type protein 5 (ZMAT5) . Q9UDW3

The Drug(s) Related To This Target

Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Lirilumab Monoclonal antibody D0I7PU

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264