Details of the Target
General Information of Target
| Target ID | LDTP04587 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA-directed RNA polymerases I, II, and III subunit RPABC4 (POLR2K) | |||||
| Gene Name | POLR2K | |||||
| Gene ID | 5440 | |||||
| Synonyms |
DNA-directed RNA polymerases I, II, and III subunit RPABC4; RNA polymerases I, II, and III subunit ABC4; ABC10-alpha; DNA-directed RNA polymerase II subunit K; RNA polymerase II 7.0 kDa subunit; RPB7.0; RPB10alpha
|
|||||
| 3D Structure | ||||||
| Sequence |
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Archaeal Rpo12/eukaryotic RPC10 RNA polymerase subunit family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
 |
C36(0.33) | LDD2100 | [1] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0524 | 2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide | MDA-MB-231 | C36(1.01) | LDD2117 | [1] |
| LDCM0507 | Nucleophilic fragment 16b | MDA-MB-231 | C36(0.33) | LDD2100 | [1] |
| LDCM0521 | Nucleophilic fragment 23b | MDA-MB-231 | C36(0.62) | LDD2114 | [1] |
| LDCM0552 | Nucleophilic fragment 6a | MDA-MB-231 | C36(1.01) | LDD2146 | [1] |
References