General Information of Target

Target ID LDTP04563
Target Name Protein FosB (FOSB)
Gene Name FOSB
Gene ID 2354
Synonyms
G0S3; Protein FosB; FosB proto-oncogene, AP-1 transcription factor subunit; G0/G1 switch regulatory protein 3; Transcription factor AP-1 subunit FosB
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
Target Bioclass
Transcription factor
Family
BZIP family, Fos subfamily
Subcellular location
Nucleus
Function
Heterodimerizes with proteins of the JUN family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to gene promoters containing an AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing their transcriptional activity. As part of the AP-1 complex, facilitates enhancer selection together with cell-type-specific transcription factors by collaboratively binding to nucleosomal enhancers and recruiting the SWI/SNF (BAF) chromatin remodeling complex to establish accessible chromatin. Together with JUN, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway. Exhibits transactivation activity in vitro. Involved in the display of nurturing behavior towards newborns. May play a role in neurogenesis in the hippocampus and in learning and memory-related tasks by regulating the expression of various genes involved in neurogenesis, depression and epilepsy. Implicated in behavioral responses related to morphine reward and spatial memory.; [Isoform 11]: Exhibits lower transactivation activity than isoform 1 in vitro. The heterodimer with JUN does not display any transcriptional activity, and may thereby act as an transcriptional inhibitor. May be involved in the regulation of neurogenesis in the hippocampus. May play a role in synaptic modifications in nucleus accumbens medium spiny neurons and thereby play a role in adaptive and pathological reward-dependent learning, including maladaptive responses involved in drug addiction. Seems to be more stably expressed with a half-life of ~9.5 hours in cell culture as compared to 1.5 hours half-life of isoform 1.
Uniprot ID
P53539
Ensemble ID
ENST00000353609.8
HGNC ID
HGNC:3797
ChEMBL ID
CHEMBL4630821

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NUGC3 SNV: p.R239I .
REH SNV: p.D250N .
SUPT1 SNV: p.A117V .
SW1990 SNV: p.A236V .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info 
N.A.  LDD0165  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alanine--glyoxylate aminotransferase (AGXT) Class-V pyridoxal-phosphate-dependent aminotransferase family P21549
Tyrosine-protein kinase transmembrane receptor ROR2 (ROR2) Tyr protein kinase family Q01974
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Transcription factor JunB (JUNB) BZIP family P17275
Zinc finger protein GLIS2 (GLIS2) GLI C2H2-type zinc-finger protein family Q9BZE0
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
PHD finger protein 1 (PHF1) Polycomblike family O43189
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
Forkhead box protein P3 (FOXP3) . Q9BZS1
Pogo transposable element with ZNF domain (POGZ) . Q7Z3K3
T-cell leukemia homeobox protein 3 (TLX3) . O43711
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-dependent transcription factor ATF-2 (ATF2) BZIP family P15336
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Centromere protein O (CENPO) CENP-O/MCM21 family Q9BU64
Protein FAM222B (FAM222B) FAM222 family Q8WU58
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Cytohesin-4 (CYTH4) . Q9UIA0
Cytoplasmic protein NCK2 (NCK2) . O43639
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Zinc finger CCCH domain-containing protein 10 (ZC3H10) . Q96K80

References

1 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060