General Information of Target

Target ID LDTP04505
Target Name Tyrosine-protein kinase JAK3 (JAK3)
Gene Name JAK3
Gene ID 3718
Synonyms
Tyrosine-protein kinase JAK3; EC 2.7.10.2; Janus kinase 3; JAK-3; Leukocyte janus kinase; L-JAK
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
Target Type
Successful
Target Bioclass
Enzyme
Family
Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Subcellular location
Endomembrane system
Function
Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A and STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.
TTD ID
T23172
Uniprot ID
P52333
DrugMap ID
TTT7PJU
Ensemble ID
ENST00000458235.7
HGNC ID
HGNC:6193
ChEMBL ID
CHEMBL2148

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 SNV: p.P37A .
CHL1 Substitution: p.D130P .
CMK SNV: p.A572V DBIA    Probe Info 
DAOY SNV: p.T321N DBIA    Probe Info 
DOTC24510 SNV: p.S504C .
HCT15 SNV: p.V963I; p.G987C; p.H1113R .
HEC1 SNV: p.L242P .
HT115 SNV: p.A573T .
IGROV1 SNV: p.M937T .
Ishikawa (Heraklio) 02 ER Insertion: p.Q39PfsTer13
SNV: p.H27R
.
JURKAT SNV: p.K885E .
LN18 SNV: p.W803S .
LN229 SNV: p.M1097L .
MCC13 SNV: p.W458Ter
Substitution: p.S769F
.
NCIH1155 SNV: p.R210W .
NCIH661 SNV: p.E698K .
REH SNV: p.A280V .
RPMI8226 SNV: p.S789L DBIA    Probe Info 
SKMEL24 SNV: p.L1073I .
SKMEL28 SNV: p.P693L .
SUPT1 Insertion: p.Q39PfsTer13
SNV: p.R272H;p.R403H
DBIA    Probe Info 
SW1271 SNV: p.A1079D .
TE10 SNV: p.Q932H .
TYKNU SNV: p.Q13H .
U937 SNV: p.M511I DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C934(7.28); C1048(17.38); C227(442.70)  LDD0209  [1]
IA-alkyne
 Probe Info 
C934(0.00); C1048(0.00)  LDD0166  [2]
NAIA_4
 Probe Info 
N.A.  LDD2226  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 T cell C695(7.52)  LDD1703  [4]
 LDCM0023  KB03 Jurkat C934(7.28); C1048(17.38); C227(442.70)  LDD0209  [1]
 LDCM0024  KB05 MOLM-16 C1028(2.89); C227(2.87)  LDD3334  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
KH domain-containing, RNA-binding, signal transduction-associated protein 1 (KHDRBS1) KHDRBS family Q07666
Nucleosome assembly protein 1-like 1 (NAP1L1) Nucleosome assembly protein (NAP) family P55209
Melanoma-associated antigen D2 (MAGED2) . Q9UNF1

The Drug(s) Related To This Target

Approved
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Baricitinib Small molecular drug DB11817
Fostamatinib Small molecular drug DB12010
Ruxolitinib Small molecular drug DB08877
Tofacitinib Small molecular drug D0EG1I
Abrocitinib . DB14973
Zanubrutinib . DB15035
Phase 3
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Asp-015k Small molecular drug D06EIC
Vx-509 Small molecular drug D04QWQ
Pf-06651600 . D02TUL
Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ati-501 Small molecular drug D6INZ9
Ati-502 Small molecular drug D6N5UC
Cerdulatinib . D0BI3N
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Sna-125 . D0Q0IM
Investigative
Click To Hide/Show 14 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
2-tert-butyl-9-fluoro-16-dihydrobenzo[H]Imidazo[45-f]Isoquinolin-7-one Small molecular drug DB04716
6-o-tolylquinazolin-2-amine Small molecular drug D09HXU
Atropisomer 1 Small molecular drug D05MHL
Cmp-6 Small molecular drug D0IR6U
Nc1153 Small molecular drug D0P1BK
Pf-956980 Small molecular drug D0V6VQ
Pmid15546730c2 Small molecular drug D08RZB
Pmid21493067c1d Small molecular drug D02NNT
Pmid24359159c19a Small molecular drug D0US9O
Whi-p154 Small molecular drug D0E5IP
Zm-39923 Small molecular drug D0YX5U
Ad-412 . D0M2AN
R-348 . DB06321
Vx-467 . D0G7YF
Patented
Click To Hide/Show 65 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,2,4-triazolo[1,5a]Pyridine Derivative 1 Small molecular drug D07XYI
Aminooxazole Carboxamide Derivative 1 Small molecular drug D05AXE
Aminotriazolopyridine Derivative 1 Small molecular drug D09ALF
Benzimidazole Derivative 7 Small molecular drug D01CRX
Bis-aminopyrimidine Derivative 2 Small molecular drug D0LR6J
Bis-aminopyrimidine Derivative 3 Small molecular drug D0S6XT
Bis-aminopyrimidine Derivative 4 Small molecular drug D0SJ1Q
Five-and-six-membered Heterocyclic Compound 1 Small molecular drug D08WPB
Imidazopyridazine Derivative 1 Small molecular drug D07BND
Imidazopyridazine Derivative 2 Small molecular drug D00PTE
Imidazopyridine Derivative 4 Small molecular drug D0P3UH
Imidazo[4,5-c]Pyridine Derivative 1 Small molecular drug D07PTU
Imidazo[4,5-c]Pyridine Derivative 2 Small molecular drug D0VJ1R
Isoxazole Derivative 1 Small molecular drug D0G9MM
Isoxazole Derivative 2 Small molecular drug D0TX2G
N-(Cyanomethyl)-4-(2-(Phenylamino)Pyrimidin-4-yl)Benzamide Derivative 1 Small molecular drug D0Y2IM
N-methylmethanesulfonamide Derivative 1 Small molecular drug D0XH7H
Pmid27774822-compound-figure10example1 Small molecular drug D0GH8D
Pmid27774822-compound-figure10example19 Small molecular drug D0W8DN
Pmid27774822-compound-figure11example5 Small molecular drug D0RJ3W
Pmid27774822-compound-figure1example20 Small molecular drug D0M3CB
Pmid27774822-compound-figure2example1-1left Small molecular drug D0E2WK
Pmid27774822-compound-figure2example1-1right Small molecular drug D0IQ6G
Pmid27774822-compound-figure2example4-3 Small molecular drug D0WB5U
Pmid27774822-compound-figure6example2 Small molecular drug D0X6DL
Pmid27774822-compound-figure6example3 Small molecular drug D09JLL
Pmid27774822-compound-figure8example5 Small molecular drug D0B9TH
Pmid27774824-compound-figure11example1up Small molecular drug D0YR8S
Pmid27774824-compound-figure12example1 Small molecular drug D0NK1R
Pmid27774824-compound-figure12example10 Small molecular drug D0UH8J
Pmid27774824-compound-figure12example61 Small molecular drug D00BYK
Pmid27774824-compound-figure2example4 Small molecular drug D0A6RG
Pmid27774824-compound-figure3example18 Small molecular drug D0U1HA
Pmid27774824-compound-figure3example7 Small molecular drug D02IET
Pmid27774824-compound-figure5example13 Small molecular drug D0T5AF
Pmid27774824-compound-figure6example12 Small molecular drug D0GB7G
Pmid27774824-compound-figure9example2down Small molecular drug D01DBB
Pmid27774824-compound-figure9example2up Small molecular drug D0WZ8N
Pyrazolopyridine Derivative 3 Small molecular drug D03QAY
Pyrazolopyridine Derivative 6 Small molecular drug D02VGC
Pyrazolopyridine Derivative 7 Small molecular drug D0D1QH
Pyrimidopyridazinone Derivative 2 Small molecular drug D0WA1V
Pyrrole Six-membered Heteroaryl Ring Derivative 1 Small molecular drug D09UBE
Pyrrolo-pyrazine Derivative 1 Small molecular drug D0EX5C
Pyrrolo-pyrazine Derivative 2 Small molecular drug D0HL5C
Pyrrolo-pyrazine Derivative 3 Small molecular drug D0JU1R
Pyrrolo-pyrazine Derivative 4 Small molecular drug D0Y6ON
Pyrrolo-pyridine Derivative 3 Small molecular drug D0VR6E
Pyrrolo[2,3-d]Pyrimidine Derivative 6 Small molecular drug D0FQ4Z
Pyrrolo[2,3-d]Pyrimidine Derivative 7 Small molecular drug D0U5FZ
Pyrrolo[2,3-d]Pyrimidine Derivative 8 Small molecular drug D0KL3B
Ruxolitinib Derivative 2 Small molecular drug D01EYJ
Tricyclic Compound 1 Small molecular drug D0G0FK
Tricyclic Compound 11 Small molecular drug D0LS1O
Tricyclic Compound 2 Small molecular drug D0QL7J
Tricyclic Heterocycle Derivative 1 Small molecular drug D0X1FD
Tricyclic Heterocycle Derivative 2 Small molecular drug D03TEE
Tricyclic Heterocycle Derivative 5 Small molecular drug D0M2WA
Tricyclic Pyrrolopyridine Compound 1 Small molecular drug D04BOW
Benzimidazole Derivative 5 . D0SX1B
Bis-aminopyrimidine Derivative 1 . D01FVC
Pyrazolopyridine Derivative 1 . D0VJ5M
Pyrazolopyridine Derivative 2 . D00ZVY
Pyrazolopyridine Derivative 4 . D09RUN
Pyrazolo[4,3-c]Pyridine Derivative 2 . D09PIS
Discontinued
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ag490 Small molecular drug D0GZ7B
Pnu156804 Small molecular drug D0Z1HQ
R348 . D01XEQ

References

1 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
5 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840