Details of the Target
General Information of Target
| Target ID | LDTP04498 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rho-related GTP-binding protein RhoN (RND2) | |||||
| Gene Name | RND2 | |||||
| Gene ID | 8153 | |||||
| Synonyms |
ARHN; RHO7; Rho-related GTP-binding protein RhoN; Rho family GTPase 2; Rho-related GTP-binding protein Rho7; Rnd2 |
|||||
| 3D Structure | ||||||
| Sequence |
MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMW
DTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCK LDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVA SLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rho family
|
|||||
| Subcellular location |
Cytoplasmic vesicle, secretory vesicle, acrosome membrane
|
|||||
| Function | May be specifically involved in neuronal and hepatic functions. Is a C3 toxin-insensitive member of the Rho subfamily. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

