Details of the Target
General Information of Target
| Target ID | LDTP04469 | |||||
|---|---|---|---|---|---|---|
| Target Name | G-protein coupled receptor 143 (GPR143) | |||||
| Gene Name | GPR143 | |||||
| Gene ID | 4935 | |||||
| Synonyms |
OA1; G-protein coupled receptor 143; Ocular albinism type 1 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP
ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor OA family
|
|||||
| Subcellular location |
Melanosome membrane
|
|||||
| Function |
Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Also plays a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C33(2.72) | LDD3369 | [1] | |
Competitor(s) Related to This Target

