Details of the Target
General Information of Target
| Target ID | LDTP04447 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-C chemokine receptor type 5 (CCR5) | |||||
| Gene Name | CCR5 | |||||
| Gene ID | 1234 | |||||
| Synonyms |
CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CHEMR13; HIV-1 fusion coreceptor; CD antigen CD195 |
|||||
| 3D Structure | ||||||
| Sequence |
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.; (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) of human immunodeficiency virus-1/HIV-1.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C323, C324(8.52) | LDD1707 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| C-C chemokine receptor type 5 (CCR5) | G-protein coupled receptor 1 family | P51681 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| T-cell surface glycoprotein CD4 (CD4) | . | P01730 | |||
Cytokine and receptor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Epithelial membrane protein 1 (EMP1) | PMP-22/EMP/MP20 family | P54849 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Maraviroc | Small molecular drug | D0NR6S | |||
| Ibalizumab | . | DB12698 | |||
Phase 3
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Pro 140 | Antibody | D1M8GC | |||
| E-913 | Small molecular drug | D0J7QU | |||
| Vicriviroc | Small molecular drug | D09JLI | |||
| Pro-140 | . | D0CG0N | |||
Phase 2
Phase 1
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Ccr5 Mab | Antibody | D0K1OK | |||
| Tak-220 | Small molecular drug | D0O9UC | |||
| Incb15050 | . | D06KNE | |||
| Vch-286 | . | D09XXH | |||
Investigative
Discontinued

