Details of the Target
General Information of Target
| Target ID | LDTP04436 | |||||
|---|---|---|---|---|---|---|
| Target Name | Caveolin-2 (CAV2) |
|
||||
| Gene Name | CAV2 | |||||
| Gene ID | 858 | |||||
| Synonyms |
Caveolin-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Caveolin family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
JW-RF-010 Probe Info |
 |
N.A. | LDD0026 | [1] | |
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [1] | |
The Interaction Atlas With This Target