Details of the Target
General Information of Target
| Target ID | LDTP04416 | |||||
|---|---|---|---|---|---|---|
| Target Name | Insulin-like 3 (INSL3) |
|
||||
| Gene Name | INSL3 | |||||
| Gene ID | 3640 | |||||
| Synonyms |
RLF; RLNL; Insulin-like 3; Leydig insulin-like peptide; Ley-I-L; Relaxin-like factor) [Cleaved into: Insulin-like 3 B chain; Insulin-like 3 A chain] |
|||||
| 3D Structure | ||||||
| Sequence |
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAT
GGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGC TQQDLLTLCPY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Insulin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| COLO320 | SNV: p.C120W | . | |||
| PC9 | Deletion: p.Q92AfsTer62 | . | |||
| REH | SNV: p.C115Y | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C1300(1.04) | LDD3319 | [1] | |
|
NAIA_5 Probe Info |
 |
C1871(0.00); C1494(0.00) | LDD2224 | [2] | |
Competitor(s) Related to This Target
References