General Information of Target

Target ID LDTP04366
Target Name PDZ and LIM domain protein 4 (PDLIM4)
Gene Name PDLIM4
Gene ID 8572
Synonyms
RIL; PDZ and LIM domain protein 4; LIM protein RIL; Reversion-induced LIM protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPS
GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR
DCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGEGGDWPGPGGPRNLKPTAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
Target Bioclass
Other
Subcellular location
Cytoplasm; Cytoplasm, cytoskeleton
Function
[Isoform 1]: Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton. In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1-containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons.; [Isoform 2]: Involved in reorganization of the actin cytoskeleton and in regulation of cell migration. In response to oxidative stress, binds to NQO1, which stabilizes it and protects it from ubiquitin-independent degradation by the core 20S proteasome. Stabilized protein is able to heterodimerize with isoform 1 changing the subcellular location of it from cytoskeleton and nuclei to cytosol, leading to loss of isoforms 1 ability to induce formation of actin stress fibers. Counteracts the effects produced by isoform 1 on organization of actin cytoskeleton and cell motility to fine-tune actin cytoskeleton rearrangement and to attenuate cell migration.
Uniprot ID
P50479
Ensemble ID
ENST00000253754.8
HGNC ID
HGNC:16501

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HKGZCC SNV: p.S11L .
HSC4 SNV: p.P245S DBIA    Probe Info 
KMCH1 SNV: p.P106T .
SW756 SNV: p.H147D .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K206(1.41); K70(9.19)  LDD0277  [1]
DBIA
 Probe Info 
C255(0.88)  LDD3310  [2]
BTD
 Probe Info 
C302(0.96)  LDD2093  [3]
HHS-475
 Probe Info 
Y213(0.54); Y293(0.63); Y322(0.81); Y191(0.87)  LDD0264  [4]
IPM
 Probe Info 
C302(0.84)  LDD1701  [3]
Lodoacetamide azide
 Probe Info 
N.A.  LDD0037  [5]
NAIA_4
 Probe Info 
N.A.  LDD2226  [6]
Phosphinate-6
 Probe Info 
N.A.  LDD0018  [7]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0558  2-Cyano-N-phenylacetamide MDA-MB-231 C302(1.07)  LDD2152  [3]
 LDCM0367  CL1 HEK-293T C44(1.22)  LDD1571  [8]
 LDCM0370  CL101 HEK-293T C44(0.97)  LDD1574  [8]
 LDCM0374  CL105 HEK-293T C44(1.12)  LDD1578  [8]
 LDCM0378  CL109 HEK-293T C44(0.85)  LDD1582  [8]
 LDCM0383  CL113 HEK-293T C44(1.10)  LDD1587  [8]
 LDCM0387  CL117 HEK-293T C44(1.50)  LDD1591  [8]
 LDCM0392  CL121 HEK-293T C44(0.92)  LDD1596  [8]
 LDCM0396  CL125 HEK-293T C44(0.95)  LDD1600  [8]
 LDCM0400  CL13 HEK-293T C44(0.93)  LDD1604  [8]
 LDCM0413  CL25 HEK-293T C44(0.93)  LDD1617  [8]
 LDCM0426  CL37 HEK-293T C44(0.83)  LDD1630  [8]
 LDCM0439  CL49 HEK-293T C44(0.78)  LDD1643  [8]
 LDCM0453  CL61 HEK-293T C44(0.83)  LDD1656  [8]
 LDCM0466  CL73 HEK-293T C44(1.31)  LDD1669  [8]
 LDCM0479  CL85 HEK-293T C44(1.14)  LDD1682  [8]
 LDCM0492  CL97 HEK-293T C44(0.93)  LDD1695  [8]
 LDCM0116  HHS-0101 DM93 Y213(0.54); Y293(0.63); Y322(0.81); Y191(0.87)  LDD0264  [4]
 LDCM0117  HHS-0201 DM93 Y293(0.31); Y213(0.46); Y316(0.70); Y191(0.71)  LDD0265  [4]
 LDCM0118  HHS-0301 DM93 Y293(0.26); Y213(0.50); Y191(0.65); Y316(0.96)  LDD0266  [4]
 LDCM0119  HHS-0401 DM93 Y293(0.67); Y322(0.78); Y316(0.80); Y213(1.04)  LDD0267  [4]
 LDCM0120  HHS-0701 DM93 Y191(0.39); Y316(0.80); Y322(0.93); Y213(1.13)  LDD0268  [4]
 LDCM0022  KB02 42-MG-BA C72(1.79); C255(1.56); C302(1.64)  LDD2244  [2]
 LDCM0023  KB03 MDA-MB-231 C302(0.84)  LDD1701  [3]
 LDCM0024  KB05 COLO792 C255(0.88)  LDD3310  [2]
 LDCM0500  Nucleophilic fragment 13a MDA-MB-231 C302(0.96)  LDD2093  [3]
 LDCM0536  Nucleophilic fragment 31 MDA-MB-231 C302(1.08)  LDD2129  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Syntenin-1 (SDCBP) . O00560
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-1 (ACTN1) Alpha-actinin family P12814
Protein FAM222B (FAM222B) FAM222 family Q8WU58

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
5 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
8 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402