Details of the Target
General Information of Target
Target ID | LDTP04344 | |||||
---|---|---|---|---|---|---|
Target Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 (GNG10) | |||||
Gene Name | GNG10 | |||||
Gene ID | 2790 | |||||
Synonyms |
GNGT10; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 |
|||||
3D Structure | ||||||
Sequence |
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFR
EPRSCALL |
|||||
Target Bioclass |
Other
|
|||||
Family |
G protein gamma family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IPM Probe Info |
![]() |
C44(1.92) | LDD1702 | [1] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [2] | |
VSF Probe Info |
![]() |
N.A. | LDD0007 | [3] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transcription factor 4 (TCF4) | . | P15884 |
Other
References