Details of the Target

General Information of Target

Target ID LDTP04326
Target Name Sperm mitochondrial-associated cysteine-rich protein (SMCP)
Gene Name SMCP
Gene ID 4184
Synonyms
MCS; MCSP; Sperm mitochondrial-associated cysteine-rich protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQ
PKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Target Bioclass
Other
Subcellular location
Cytoplasm
Function
Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida.
Uniprot ID
P49901
Ensemble ID
ENST00000368765.4
HGNC ID
HGNC:6962

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C99(2.30)  LDD3492  [1]
IPM
 Probe Info  		N.A.  LDD0147  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 ETK-1 C99(1.16)  LDD2325  [1]
 LDCM0023  KB03 YSCCC C99(1.86)  LDD3075  [1]
 LDCM0024  KB05 YSCCC C99(2.30)  LDD3492  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alkaline phosphatase, placental type (ALPP) Alkaline phosphatase family P05187
Peroxiredoxin-5, mitochondrial (PRDX5) Peroxiredoxin family P30044
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Macoilin (MACO1) Macoilin family Q8N5G2
Phospholipid scramblase 3 (PLSCR3) Phospholipid scramblase family Q9NRY6
Zinc transporter SLC39A7 (SLC39A7) ZIP transporter (TC 2.A.5) family Q92504
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor 4 (TCF4) . P15884
Other
Click To Hide/Show 59 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Dynein light chain 1, cytoplasmic (DYNLL1) Dynein light chain family P63167
Dynein light chain 2, cytoplasmic (DYNLL2) Dynein light chain family Q96FJ2
Choriogonadotropin subunit beta 3 (CGB3; CGB5; CGB8) Glycoprotein hormones subunit beta family P0DN86
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Progranulin (GRN) Granulin family P28799
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 1-5 (KRTAP1-5) KRTAP type 1 family Q9BYS1
Keratin-associated protein 10-11 (KRTAP10-11) KRTAP type 10 family P60412
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-1 (KRTAP12-1) KRTAP type 12 family P59990
Keratin-associated protein 12-4 (KRTAP12-4) KRTAP type 12 family P60329
Keratin-associated protein 4-1 (KRTAP4-1) KRTAP type 4 family Q9BYQ7
Keratin-associated protein 4-11 (KRTAP4-11) KRTAP type 4 family Q9BYQ6
Keratin-associated protein 4-12 (KRTAP4-12) KRTAP type 4 family Q9BQ66
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 4-4 (KRTAP4-4) KRTAP type 4 family Q9BYR3
Keratin-associated protein 4-5 (KRTAP4-5) KRTAP type 4 family Q9BYR2
Keratin-associated protein 4-7 (KRTAP4-7) KRTAP type 4 family Q9BYR0
Keratin-associated protein 5-11 (KRTAP5-11) KRTAP type 5 family Q6L8G4
Keratin-associated protein 5-2 (KRTAP5-2) KRTAP type 5 family Q701N4
Keratin-associated protein 5-3 (KRTAP5-3) KRTAP type 5 family Q6L8H2
Keratin-associated protein 5-4 (KRTAP5-4) KRTAP type 5 family Q6L8H1
Keratin-associated protein 5-6 (KRTAP5-6) KRTAP type 5 family Q6L8G9
Keratin-associated protein 5-9 (KRTAP5-9) KRTAP type 5 family P26371
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Keratin-associated protein 9-4 (KRTAP9-4) KRTAP type 9 family Q9BYQ2
Keratin-associated protein 9-8 (KRTAP9-8) KRTAP type 9 family Q9BYQ0
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 1B (LCE1B) LCE family Q5T7P3
Late cornified envelope protein 1D (LCE1D) LCE family Q5T752
Late cornified envelope protein 1E (LCE1E) LCE family Q5T753
Late cornified envelope protein 1F (LCE1F) LCE family Q5T754
Late cornified envelope protein 2C (LCE2C) LCE family Q5TA81
Late cornified envelope protein 2D (LCE2D) LCE family Q5TA82
Late cornified envelope protein 3A (LCE3A) LCE family Q5TA76
Late cornified envelope protein 3B (LCE3B) LCE family Q5TA77
Late cornified envelope protein 4A (LCE4A) LCE family Q5TA78
Late cornified envelope protein 5A (LCE5A) LCE family Q5TCM9
Metallothionein-1B (MT1B) Type 1 family P07438
Metallothionein-1M (MT1M) Type 1 family Q8N339
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Insulin-like growth factor-binding protein 6 (IGFBP6) . P24592
Protein phosphatase 1 regulatory subunit 27 (PPP1R27) . Q86WC6
Puratrophin-1 (PLEKHG4) . Q58EX7
Regulator of G-protein signaling 17 (RGS17) . Q9UGC6
Ubiquitin-like protein 5 (UBL5) . Q9BZL1
Uncharacterized protein C14orf119 (C14orf119) . Q9NWQ9
Vasorin (VASN) . Q6EMK4

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255