Details of the Target
General Information of Target
| Target ID | LDTP04269 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein Hox-A1 (HOXA1) | |||||
| Gene Name | HOXA1 | |||||
| Gene ID | 3198 | |||||
| Synonyms |
HOX1F; Homeobox protein Hox-A1; Homeobox protein Hox-1F |
|||||
| 3D Structure | ||||||
| Sequence |
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ
IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Antp homeobox family, Labial subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Sequence-specific transcription factor. Regulates multiple developmental processes including brainstem, inner and outer ear, abducens nerve and cardiovascular development and morphogenesis as well as cognition and behavior. Also part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments. Activates transcription in the presence of PBX1A and PKNOX1.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C40(1.13); C47(1.13) | LDD0078 | [1] | |
Competitor(s) Related to This Target

