Details of the Target
General Information of Target
| Target ID | LDTP04257 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H3-like centromeric protein A (CENPA) |
|
||||
| Gene Name | CENPA | |||||
| Gene ID | 1058 | |||||
| Synonyms |
Histone H3-like centromeric protein A; Centromere autoantigen A; Centromere protein A; CENP-A |
|||||
| 3D Structure | ||||||
| Sequence |
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHL
LIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVT LFPKDVQLARRIRGLEEGLG |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H3 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin that serves as an assembly site for the inner kinetochore. The presence of CENPA subtly modifies the nucleosome structure and the way DNA is wrapped around the nucleosome and gives rise to protruding DNA ends that are less well-ordered and rigid compared to nucleosomes containing histone H3. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. Required for recruitment and assembly of kinetochore proteins, and as a consequence required for progress through mitosis, chromosome segregation and cytokinesis .
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
 |
N.A. | LDD0226 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| DNA replication licensing factor MCM2 (MCM2) | MCM family | P49736 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Optineurin (OPTN) | . | Q96CV9 | |||
Other