General Information of Target

Target ID LDTP04216
Target Name CCN family member 3 (CCN3)
Gene Name CCN3
Gene ID 4856
Synonyms
IGFBP9; NOV; NOVH; CCN family member 3; Cellular communication network factor 3; Insulin-like growth factor-binding protein 9; IBP-9; IGF-binding protein 9; IGFBP-9; Nephro blastoma-overexpressed gene protein homolog; Protein NOV homolog; NovH
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Target Bioclass
Transporter and channel
Family
CCN family
Subcellular location
Secreted
Function
Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival. Acts by binding to integrins or membrane receptors such as NOTCH1. Essential regulator of hematopoietic stem and progenitor cell function. Inhibits myogenic differentiation through the activation of Notch-signaling pathway. Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling. Ligand of integrins ITGAV:ITGB3 and ITGA5:ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival. Also plays a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5:ITGB1 and ITGA6:ITGB1 and induces fibroblast chemotaxis through ITGAV:ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts. Involved in bone regeneration as a negative regulator. Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification. Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion. Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway. Contributes to the control and coordination of inflammatory processes in atherosclerosis. Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement.
Uniprot ID
P48745
Ensemble ID
ENST00000259526.4
HGNC ID
HGNC:7885

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C315(1.59)  LDD3427  [1]
Acrolein
 Probe Info 
N.A.  LDD0231  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0020  ARS-1620 HCC44 C43(1.20); C50(1.20); C300(1.07); C301(1.07)  LDD2171  [3]
 LDCM0022  KB02 A2058 C127(4.19)  LDD2253  [1]
 LDCM0023  KB03 A2058 C127(3.78)  LDD2670  [1]
 LDCM0024  KB05 SK-MEL-28 C315(1.59)  LDD3427  [1]
 LDCM0109  NEM HeLa N.A.  LDD0231  [2]
 LDCM0021  THZ1 HCT 116 C43(1.20); C50(1.20); C300(1.07); C301(1.07)  LDD2173  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Macoilin (MACO1) Macoilin family Q8N5G2
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein L6 (APOL6) Apolipoprotein L family Q9BWW8
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Keratin-associated protein 5-6 (KRTAP5-6) KRTAP type 5 family Q6L8G9
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 3D (LCE3D) LCE family Q9BYE3
Zinc finger protein 330 (ZNF330) NOA36 family Q9Y3S2
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
TNFAIP3-interacting protein 3 (TNIP3) . Q96KP6
Uncharacterized protein C11orf87 (C11orf87) . Q6NUJ2

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Insulin Human BiotechDrug DB00030

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.