Details of the Target
General Information of Target
| Target ID | LDTP04139 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein CDX-1 (CDX1) | |||||
| Gene Name | CDX1 | |||||
| Gene ID | 1044 | |||||
| Synonyms |
Homeobox protein CDX-1; Caudal-type homeobox protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTA
WGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPG TPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT IRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQPPMAHDITATPAGPSL GGLCPSNTSLLATSSPMPVKEEFLP |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Caudal homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Plays a role in transcriptional regulation. Involved in activated KRAS-mediated transcriptional activation of PRKD1 in colorectal cancer (CRC) cells. Binds to the PRKD1 promoter in colorectal cancer (CRC) cells. Could play a role in the terminal differentiation of the intestine. Binds preferentially to methylated DNA.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

