Details of the Target
General Information of Target
| Target ID | LDTP04063 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox protein Nkx-2.1 (NKX2-1) |
|
||||
| Gene Name | NKX2-1 | |||||
| Gene ID | 7080 | |||||
| Synonyms |
NKX2A; TITF1; TTF1; Homeobox protein Nkx-2.1; Homeobox protein NK-2 homolog A; Thyroid nuclear factor 1; Thyroid transcription factor 1; TTF-1; Thyroid-specific enhancer-binding protein; T/EBP |
|||||
| 3D Structure | ||||||
| Sequence |
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGH
HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG GTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTM SCSTLLYGRTW |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
NK-2 homeobox family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C445(2.03) | LDD3312 | [1] | |
|
NAIA_5 Probe Info |
 |
C73(0.00); C708(0.00) | LDD2224 | [2] | |
Competitor(s) Related to This Target
References