Details of the Target

General Information of Target

Target ID LDTP04042
Target Name Melanoma-associated antigen 6 (MAGEA6)
Gene Name MAGEA6
Gene ID 4105
Synonyms
MAGE6; Melanoma-associated antigen 6; Cancer/testis antigen 1.6; CT1.6; MAGE-6 antigen; MAGE3B antigen
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
YPLLHEWALREGEE
Target Type
Clinical trial
Target Bioclass
Other
Function
Activator of ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases that acts as a repressor of autophagy. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines.
TTD ID
T57941
Uniprot ID
P43360
DrugMap ID
TTJIWMO
Ensemble ID
ENST00000329342.10
HGNC ID
HGNC:6804

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD2156  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3',5'-cyclic-AMP phosphodiesterase 4D (PDE4D) Cyclic nucleotide phosphodiesterase family Q08499
Glucose-fructose oxidoreductase domain-containing protein 1 (GFOD1) Gfo/Idh/MocA family Q9NXC2
AMSH-like protease (STAMBPL1) Peptidase M67C family Q96FJ0
Pterin-4-alpha-carbinolamine dehydratase 2 (PCBD2) Pterin-4-alpha-carbinolamine dehydratase family Q9H0N5
Kinesin-like protein KIF27 (KIF27) Kinesin family Q86VH2
Transcription intermediary factor 1-beta (TRIM28) TRIM/RBCC family Q13263
Tripartite motif-containing protein 26 (TRIM26) TRIM/RBCC family Q12899
Cytosolic acyl coenzyme A thioester hydrolase (ACOT7) . O00154
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Exocyst complex component 5 (EXOC5) SEC10 family O00471
Sorting nexin-4 (SNX4) Sorting nexin family O95219
Syntaxin-5 (STX5) Syntaxin family Q13190
V-type proton ATPase subunit G 1 (ATP6V1G1) V-ATPase G subunit family O75348
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
Deoxynucleotidyltransferase terminal-interacting protein 1 (DNTTIP1) . Q9H147
Ligand-dependent nuclear receptor corepressor-like protein (LCORL) . Q8N3X6
Mesogenin-1 (MSGN1) . A6NI15
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cardiotrophin-1 (CTF1) IL-6 superfamily Q16619
Other
Click To Hide/Show 44 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
Apolipoprotein A-IV (APOA4) Apolipoprotein A1/A4/E family P06727
Atos homolog protein A (ATOSA) ATOS family Q32MH5
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
B-cell CLL/lymphoma 7 protein family member B (BCL7B) BCL7 family Q9BQE9
BET1 homolog (BET1) BET1 family O15155
BolA-like protein 3 (BOLA3) BolA/IbaG family Q53S33
Large ribosomal subunit protein eL43 (RPL37A) Eukaryotic ribosomal protein eL43 family P61513
Glycine cleavage system H protein, mitochondrial (GCSH) GcvH family P23434
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Phakinin (BFSP2) Intermediate filament family Q13515
Protein lin-52 homolog (LIN52) Lin-52 family Q52LA3
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Testis-specific Y-encoded-like protein 6 (TSPYL6) Nucleosome assembly protein (NAP) family Q8N831
Protein S100-A14 (S100A14) S-100 family Q9HCY8
Protein S100-A9 (S100A9) S-100 family P06702
Disks large-associated protein 3 (DLGAP3) SAPAP family O95886
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
U6 snRNA-associated Sm-like protein LSm2 (LSM2) SnRNP Sm proteins family Q9Y333
Synaptosomal-associated protein 47 (SNAP47) SVAP1 family Q5SQN1
Tubby-related protein 3 (TULP3) TUB family O75386
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
DNA repair protein XRCC4 (XRCC4) XRCC4-XLF family Q13426
AP-4 complex accessory subunit RUSC1 (RUSC1) . Q9BVN2
Arfaptin-1 (ARFIP1) . P53367
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
Coiled-coil domain-containing protein 24 (CCDC24) . Q8N4L8
Cytoplasmic protein NCK2 (NCK2) . O43639
ELMO domain-containing protein 3 (ELMOD3) . Q96FG2
FERM and PDZ domain-containing protein 1 (FRMPD1) . Q5SYB0
Heterogeneous nuclear ribonucleoprotein M (HNRNPM) . P52272
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Microspherule protein 1 (MCRS1) . Q96EZ8
Mirror-image polydactyly gene 1 protein (MIPOL1) . Q8TD10
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Protein lin-37 homolog (LIN37) . Q96GY3
Putative ankyrin repeat domain-containing protein 26-like protein (ANKRD26P1) . Q6NSI1
Ras association domain-containing protein 10 (RASSF10) . A6NK89
Ras association domain-containing protein 4 (RASSF4) . Q9H2L5
Required for excision 1-B domain-containing protein (REX1BD) . Q96EN9
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
Thioredoxin domain-containing protein 9 (TXNDC9) . O14530

The Drug(s) Related To This Target

Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Kite-718 TCR-T cell therapy DN46RL

References

1 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019