Details of the Target
General Information of Target
Target ID | LDTP04006 | |||||
---|---|---|---|---|---|---|
Target Name | Neuronal vesicle trafficking-associated protein 1 (NSG1) | |||||
Gene Name | NSG1 | |||||
Gene ID | 27065 | |||||
Synonyms |
D4S234; NEEP21; Neuronal vesicle trafficking-associated protein 1; Neuron-enriched endosomal protein of 21 kDa; Neuron-specific protein family member 1 |
|||||
3D Structure | ||||||
Sequence |
MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGK
ARPPQIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKN TQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEA AEKSA |
|||||
Target Bioclass |
Other
|
|||||
Family |
NSG family
|
|||||
Subcellular location |
Membrane
|
|||||
Function |
Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA2 through interaction with GRIP1 and then contributes to the regulation of synaptic transmission and plasticity by affecting the recycling and targeting of AMPA receptors to the synapse. Is required for faithful sorting of L1CAM to axons by facilitating trafficking from somatodendritic early endosome or the recycling endosome. In an other hand, induces apoptosis via the activation of CASP3 in response to DNA damage.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C112(0.92) | LDD1509 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0226 | AC11 | HEK-293T | C112(0.92) | LDD1509 | [1] |
LDCM0278 | AC19 | HEK-293T | C112(0.93) | LDD1517 | [1] |
LDCM0287 | AC27 | HEK-293T | C112(0.92) | LDD1526 | [1] |
LDCM0290 | AC3 | HEK-293T | C112(0.98) | LDD1529 | [1] |
LDCM0296 | AC35 | HEK-293T | C112(1.00) | LDD1535 | [1] |
LDCM0305 | AC43 | HEK-293T | C112(0.91) | LDD1544 | [1] |
LDCM0314 | AC51 | HEK-293T | C112(0.83) | LDD1553 | [1] |
LDCM0322 | AC59 | HEK-293T | C112(0.98) | LDD1561 | [1] |
LDCM0406 | CL19 | HEK-293T | C112(1.00) | LDD1610 | [1] |
LDCM0420 | CL31 | HEK-293T | C112(1.09) | LDD1624 | [1] |
LDCM0433 | CL43 | HEK-293T | C112(0.96) | LDD1637 | [1] |
LDCM0446 | CL55 | HEK-293T | C112(0.99) | LDD1649 | [1] |
LDCM0459 | CL67 | HEK-293T | C112(1.03) | LDD1662 | [1] |
LDCM0462 | CL7 | HEK-293T | C112(1.07) | LDD1665 | [1] |
LDCM0472 | CL79 | HEK-293T | C112(0.92) | LDD1675 | [1] |
LDCM0486 | CL91 | HEK-293T | C112(0.98) | LDD1689 | [1] |