Details of the Target
General Information of Target
| Target ID | LDTP04002 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cyclin-dependent kinase 4 inhibitor B (CDKN2B) | |||||
| Gene Name | CDKN2B | |||||
| Gene ID | 1030 | |||||
| Synonyms |
MTS2; Cyclin-dependent kinase 4 inhibitor B; Multiple tumor suppressor 2; MTS-2; p14-INK4b; p15-INK4b; p15INK4B |
|||||
| 3D Structure | ||||||
| Sequence |
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR
VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CDKN2 cyclin-dependent kinase inhibitor family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C74(1.24) | LDD3384 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [3] |
| LDCM0107 | IAA | HeLa | C74(0.00); H100(0.00) | LDD0221 | [3] |
| LDCM0022 | KB02 | Caov-3 | C74(1.28) | LDD2295 | [1] |
| LDCM0023 | KB03 | Caov-3 | C74(1.35) | LDD2712 | [1] |
| LDCM0024 | KB05 | OVCAR-8 | C74(1.24) | LDD3384 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| V-type proton ATPase subunit H (ATP6V1H) | V-ATPase H subunit family | Q9UI12 | |||
Other
References



