Details of the Target
General Information of Target
| Target ID | LDTP03932 | |||||
|---|---|---|---|---|---|---|
| Target Name | Regulator of G-protein signaling 2 (RGS2) |
|
||||
| Gene Name | RGS2 | |||||
| Gene ID | 5997 | |||||
| Synonyms |
G0S8; Regulator of G-protein signaling 2; RGS2; Cell growth-inhibiting gene 31 protein; G0/G1 switch regulatory protein 8 |
|||||
| 3D Structure | ||||||
| Sequence |
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL MENNSYPRFLESEFYQDLCKKPQITTEPHAT |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. It is involved in the negative regulation of the angiotensin-activated signaling pathway. Plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. Plays a role in regulating the constriction and relaxation of vascular smooth muscle. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C199(0.99) | LDD1492 | [1] | |
Competitor(s) Related to This Target