Details of the Target

General Information of Target

Target ID LDTP03738
Target Name Alpha-1B adrenergic receptor (ADRA1B)
Gene Name ADRA1B
Gene ID 147
Synonyms
Alpha-1B adrenergic receptor; Alpha-1B adrenoreceptor; Alpha-1B adrenoceptor
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Target Type
Successful
Target Bioclass
GPCR
Family
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1B sub-subfamily
Subcellular location
Nucleus membrane
Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes.
TTD ID
T29500
Uniprot ID
P35368
DrugMap ID
TTBRKXS
Ensemble ID
ENST00000306675.5
HGNC ID
HGNC:278
ChEMBL ID
CHEMBL232

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		N.A.  LDD0162  [1]

The Interaction Atlas With This Target

The Drug(s) Related To This Target

Approved
Click To Hide/Show 77 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Alfuzosin Small molecular drug DB00346
Amitriptyline Small molecular drug DB00321
Amoxapine Small molecular drug DB00543
Amphetamine Small molecular drug DB00182
Aripiprazole Small molecular drug DB01238
Brexpiprazole Small molecular drug DB09128
Bromocriptine Small molecular drug DB01200
Buspirone Small molecular drug DB00490
Cabergoline Small molecular drug DB00248
Carvedilol Small molecular drug DB01136
Chlorpromazine Small molecular drug DB00477
Clonidine Small molecular drug DB00575
Clozapine Small molecular drug DB00363
Dapiprazole Small molecular drug DB00298
Desipramine Small molecular drug DB01151
Dextroamphetamine Small molecular drug DB01576
Dihydroergotamine Small molecular drug DB00320
Dobutamine Small molecular drug DB00841
Doxazosin Small molecular drug DB00590
Doxepin Small molecular drug DB01142
Dronedarone Small molecular drug DB04855
Droxidopa Small molecular drug DB06262
Epinephrine Small molecular drug DB00668
Ergotamine Small molecular drug DB00696
Escitalopram Small molecular drug DB01175
Fenoldopam Small molecular drug DB00800
Imipramine Small molecular drug DB00458
Labetalol Small molecular drug DB00598
Loxapine Small molecular drug DB00408
Maprotiline Small molecular drug DB00934
Methamphetamine Small molecular drug D0P6UB
Methotrimeprazine Small molecular drug DB01403
Methoxamine Small molecular drug D09GYT
Mianserin Small molecular drug DB06148
Midodrine Small molecular drug DB00211
Mirtazapine Small molecular drug DB00370
Modafinil Small molecular drug DB00745
Nefazodone Small molecular drug DB01149
Nicardipine Small molecular drug DB00622
Norepinephrine Small molecular drug DB00368
Nortriptyline Small molecular drug DB00540
Olanzapine Small molecular drug DB00334
Oxymetazoline Small molecular drug DB00935
Paliperidone Small molecular drug DB01267
Paroxetine Small molecular drug DB00715
Pergolide Small molecular drug DB01186
Periciazine Small molecular drug DB01608
Phendimetrazine Small molecular drug D0T6SU
Phenoxybenzamine Small molecular drug DB00925
Phentolamine Small molecular drug DB00692
Phenylephrine Small molecular drug DB00388
Pizotifen Small molecular drug DB06153
Prazosin Small molecular drug DB00457
Prochlorperazine Small molecular drug DB00433
Promethazine Small molecular drug DB01069
Propericiazine Small molecular drug D00AWT
Quetiapine Small molecular drug DB01224
Quinidine Small molecular drug DB00908
Ranolazine Small molecular drug DB00243
Risperidone Small molecular drug DB00734
Ropinirole Small molecular drug DB00268
Sertindole Small molecular drug DB06144
Silodosin Small molecular drug DB06207
Tamsulosin Small molecular drug DB00706
Terazosin Small molecular drug DB01162
Thioridazine Small molecular drug DB00679
Tizanidine Small molecular drug DB00697
Trimipramine Small molecular drug DB00726
Verapamil Small molecular drug DB00661
Xylometazoline Small molecular drug DB06694
Ziprasidone Small molecular drug DB00246
Aripiprazole Lauroxil . DB14185
Dl-methylephedrine . DB11278
Dosulepin . DB09167
Lorpiprazole . DB09195
Racepinephrine . DB11124
Viloxazine . DB09185
Phase 2
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Medetomidine Small molecular drug D0F2ML
Investigative
Click To Hide/Show 55 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(2,6-dichloro-phenyl)-(1h-imidazol-2-yl)-amine Small molecular drug D0A6GK
(2-bromo-phenyl)-(1h-imidazol-2-yl)-amine Small molecular drug D06HHJ
2-pyridin-4-yl-1,2,3,4-tetrahydro-isoquinoline Small molecular drug D0B4DP
4-((E)-1-naphthalen-1-yl-propenyl)-1h-imidazole Small molecular drug D0RX6I
4-((Z)-1-naphthalen-1-yl-propenyl)-1h-imidazole Small molecular drug D0F3AR
4-(1-naphthalen-1-yl-ethyl)-1h-imidazole Small molecular drug D0P5PW
4-(1-naphthalen-1-yl-propyl)-1h-imidazole Small molecular drug D0ZP5X
4-(1-naphthalen-1-yl-vinyl)-1h-imidazole Small molecular drug D07XDL
4-(2,3-dihydro-1h-phenalen-1-yl)-1h-imidazole Small molecular drug D09NXU
4-(3,4-dihydro-1h-isoquinolin-2-yl)-quinoline Small molecular drug D0K9NW
4-(3-hydroxy-piperidin-3-yl)-benzene-1,2-diol Small molecular drug D0T5KJ
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Small molecular drug D0T2RY
4-(4-isopropyl-morpholin-2-yl)-benzene-1,2-diol Small molecular drug D06QKD
4-(4-methyl-indan-1-yl)-1h-imidazole Small molecular drug D0L9WN
4-benzo[B]Thiophen-4-yl-1h-imidazole Small molecular drug D0H3NA
4-morpholin-2-yl-benzene-1,2-diol Small molecular drug D0S1GH
5-methylurapidil Small molecular drug D0V6DJ
6-fluoronorepinehprine Small molecular drug D04BYL
A-119637 Small molecular drug D0Q7ZR
A-123189 Small molecular drug D0EO4F
Acepromazine Small molecular drug DB01614
Agn-192172 Small molecular drug D0L6JS
Ah 11110 Small molecular drug D0FH7B
Cirazoline Small molecular drug DB09202
Corynantheine Small molecular drug D09CKI
Cyclazosin Small molecular drug D0DP8I
Fluanisone Small molecular drug D01TOU
Imidazolidin-2-ylidene-o-tolyl-amine Small molecular drug D09PIF
Imidazolidin-2-ylidene-quinoxalin-6-yl-amine Small molecular drug D0N7UE
Isoclozapine Small molecular drug D0P0IX
Levonordefrin Small molecular drug D0E9VU
N-(5-bromo-quinoxalin-6-yl)-guanidine Small molecular drug D02TQC
Ocaperidone Small molecular drug DB06229
Octoclothepin Small molecular drug D0D3YN
Perospirone Small molecular drug DB08922
Rec 15/2615 Small molecular drug D06ABL
Rwj-68157 Small molecular drug D0Q4PY
Rwj-69736 Small molecular drug D08XTL
Sk&f-105854 Small molecular drug D0H3CW
Sk&f-106686 Small molecular drug D07QCC
Sk&f-86466 Small molecular drug D06UBB
Snap-8719 Small molecular drug D02NNS
Spiroxatrine Small molecular drug D0MU4A
Thioproperazine Small molecular drug DB01622
Tiapride Small molecular drug DB13025
Uh-301 Small molecular drug D06ROA
[125i]Be-2254 Small molecular drug D03YLQ
[125i]Heat Small molecular drug D09DKC
[3h]Rx821002 Small molecular drug D08KLH
(+/-)-nantenine . D0L5MW
Aranidipine . DB09229
Arotinolol . DB09204
Epicept Np-1 . DB05492
Pipamperone . DB09286
R450 . DB05469
Discontinued
Click To Hide/Show 14 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Abanoquil Small molecular drug D0U3HP
Agn-193080 Small molecular drug D0BC6Q
Bmy-7378 Small molecular drug D00KZF
Mazapertine Small molecular drug D01WJZ
Niguldipine Small molecular drug D05IML
Siramesine Small molecular drug D0XK2K
Sk&f-104078 Small molecular drug D08OWQ
Sk&f-104856 Small molecular drug D0N7LZ
Snap-5089 Small molecular drug D06HRY
Sunepitron Small molecular drug D03ITI
Tiospirone Small molecular drug D01RCS
Wb-4101 Small molecular drug D03QMR
Etoperidone . DB09194
Sou-001 . D08OJU

References

1 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060