Details of the Target
General Information of Target
| Target ID | LDTP03732 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cornifin-A (SPRR1A) | |||||
| Gene Name | SPRR1A | |||||
| Gene ID | 6698 | |||||
| Synonyms |
Cornifin-A; 19 kDa pancornulin; SPRK; Small proline-rich protein IA; SPR-IA |
|||||
| 3D Structure | ||||||
| Sequence |
MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPK
VPEPCQPKVPEPCPSTVTPAPAQQKTKQK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Cornifin (SPRR) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C73(1.60) | LDD3489 | [1] | |
Competitor(s) Related to This Target

